SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5YTX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5YTX2
Domain Number 1 Region: 122-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.3e-61
Family D-glucarate dehydratase-like 0.00022
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-34
Family Enolase N-terminal domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5YTX2
Sequence length 367
Comment (tr|Q5YTX2|Q5YTX2_NOCFA) Putative muconate cycloisomerase {ECO:0000313|EMBL:BAD58369.1} KW=Complete proteome; Reference proteome OX=247156 OS=Nocardia farcinica (strain IFM 10152). GN=NFA_35210 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MKITRVEAIPFAIPYRKPLRFASGEVHTAEHVLVRVHTDDGVVGVAEAPPRPFTYGETQD
SIVAVIRKLFAPQVVGLTLLQRETVAARLARTVGNPAAKAALDMAIWDALGRTLDVQVTE
LLGGYTDRLRVSHMLGFDDPAAMVAEAQRMRERHGITTFKVKVGRRPIGLDLAVVRALRE
GLGEEVELYVDGNRGWTASESARAMREMADLGLLFAEELCPADDVLGRRWLVSQLDVPFI
ADESVPTPADVTREVLAGSATAISIKIARTGFTGSQRVHHLAEGLGLEVVMGNQIDGQIG
SLCTVAFGAAFPLTSRRAAELSNFLDMSDDLLTEPLDIRGGELTVRPGAGHGAEIDPDKL
ARYRQDR
Download sequence
Identical sequences Q5YTX2
gi|54025491|ref|YP_119733.1| 247156.nfa35210 WP_011210054.1.78782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]