SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q64611 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q64611
Domain Number 1 Region: 37-492
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.81e-127
Family Pyridoxal-dependent decarboxylase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q64611
Sequence length 493
Comment (sp|Q64611|CSAD_RAT) Sulfinoalanine decarboxylase KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Csad; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MADSKPLRTLDGDPVAVEALLRDVFGIVVDEAIRKGTNASEKVCEWKEPEELKQLLDLEL
QSQGESRERILERCRAVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLKKLRALVGWNTGDGVFCPGGSISNMYAINLARFQRYPDCKQRGLRALP
PLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAEAEGSVPFL
VSATSGTTVLGAFDPLDAIADVCQRHGLWLHVDAAWGGSVLLSRTHRHLLDGIQRADSVA
WNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYNVALDTGDKVVQCGRRV
DCLKLWLMWKAQGGQGLEWRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPS
LRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILVQADID
FLLGELERLGQDL
Download sequence
Identical sequences Q64611
ENSRNOP00000016205 NP_068518.1.100692 NP_068518.1.4139 XP_006242500.1.100692 XP_006242501.1.100692 XP_006242502.1.100692 XP_006242504.1.100692 XP_008764004.1.100692 XP_017450565.1.100692 ENSRNOP00000016205 10116.ENSRNOP00000016205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]