SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q665P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q665P7
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.05e-111
Family FMN-linked oxidoreductases 0.000000000338
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.71e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000287
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.62e-22
Family C-terminal domain of adrenodoxin reductase-like 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q665P7
Sequence length 673
Comment (tr|Q665P7|Q665P7_YERPS) 2,4-dienoyl-CoA reductase {ECO:0000313|EMBL:CAH22707.1} KW=Complete proteome OX=273123 OS=Yersinia pseudotuberculosis serotype I (strain IP32953). GN=YPTB3469 OC=Yersiniaceae; Yersinia.
Sequence
MLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFYAERAAGGVGLIVTGG
IAPNMKGVVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQILHAGRYSYQKHPVAPSA
LQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIMGSEGYLINQFLTARTNQ
RDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDLVEEGSNWVEIEQLAQAVE
QAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVNIPLITTNRINDPAVAEQV
LADGCADMVSMARPFLADAAFVQKAVQGRADEINTCIGCNQACLDQIFDGKLTSCLVNPR
ACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGHQVTLFDAAAEIGGQFNIAKQI
PGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEFDEVILACGIQPRLPCINGIDHP
KVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQSGDSPRFDSTAFSTEWGIDQDLA
HRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKTTGWIHRTSLAMRGVKMLNSVSYEA
IDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELHQPLLDMGKTVYLIGGADKAVELDAR
RAIDQGTRLALAI
Download sequence
Identical sequences A0A0U1EUD2 Q665P7
273123.YPTB3469 502801.YPTS_3654 gi|51597761|ref|YP_071952.1| gi|186896952|ref|YP_001874064.1| WP_011193129.1.20932 WP_011193129.1.26383 WP_011193129.1.32736 WP_011193129.1.33324 WP_011193129.1.46697 WP_011193129.1.50185 WP_011193129.1.53883 WP_011193129.1.63641 WP_011193129.1.6791 WP_011193129.1.75208 WP_011193129.1.83630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]