SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q67K12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q67K12
Domain Number - Region: 105-140
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0327
Family Phase 1 flagellin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q67K12
Sequence length 147
Comment (tr|Q67K12|Q67K12_SYMTH) Flagellar basal-body rod protein FlgC {ECO:0000256|RuleBase:RU362062} KW=Complete proteome; Reference proteome OX=292459 OS=Symbiobacterium thermophilum (strain T / IAM 14863). GN=STH3005 OC=Symbiobacterium.
Sequence
MRMFQAMEASASALTAERLRMDVIANNLANYRTTRTAEGGPYRRRTVVVEERPNTFASEL
ARQAGRPAEPGLGVRVTQIVEDPSPFKEVHDPTHPDADPVTGIVRLPNVDLLQEITDLML
AQRMYDANLTAFNAAKNMALRALEIGR
Download sequence
Identical sequences Q67K12
292459.STH3005 gi|51894141|ref|YP_076832.1| WP_011197120.1.72803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]