SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q67K36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q67K36
Domain Number 1 Region: 1-291
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.22e-40
Family Phase 1 flagellin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q67K36
Sequence length 293
Comment (tr|Q67K36|Q67K36_SYMTH) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=292459 OS=Symbiobacterium thermophilum (strain T / IAM 14863). GN=STH2979 OC=Symbiobacterium.
Sequence
MRVTNWMLVNTAIRELEGLRAQYARAQKRVYGRALERPSDDPQRVIEAIDLTGMKVKLER
AQRAATDAKEWLSIAETSLTAMSEDLQAVYETMIQFGSPANQESTARENLALQIEGLRDA
IKREMNTQHRGRYVFAGWAADTQPFEDDGSGGVEYKGSKHKIEREIAPGYKVAINIHGDE
LPYEIIATLTEVANAIRTGTVEDVTKHLDKVQAAADELLARRSEVGLAYQQVEQFEGYSR
DGLITVEERLGKISGGDIAEAVMEMTQAQQAFQVALTAFSMALPKSLMDYMFR
Download sequence
Identical sequences Q67K36
WP_011197094.1.72803 292459.STH2979 gi|51894115|ref|YP_076806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]