SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q67K41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q67K41
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.1e-86
Family Phase 1 flagellin 0.0000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q67K41
Sequence length 275
Comment (tr|Q67K41|Q67K41_SYMTH) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=292459 OS=Symbiobacterium thermophilum (strain T / IAM 14863). GN=STH2974 OC=Symbiobacterium.
Sequence
MRINTNLAALNAWRALTINHGAMTKSLEKLSSGYRVNRAADDAAGLAVSEKMRAQIRGLN
MAVRNAQDGVSLIQTAEGGAQKIQDMLQRMRELAVQAASDTLDDPDRQLLNKEFAQLIEE
IERTANSTTFNEKELLNADAASATFDIHVGPGADPDNDVITLQMADLTDTGLKISELTIS
TKSDATTAISTLDNAIDTVSSTRATFGAYQNRLEGAIETLKIQAENLTAAESRIRDADMA
LEMATFTKYQILQQASTAMLAQANMSTQSILSLLR
Download sequence
Identical sequences Q67K41
WP_011197089.1.72803 gi|51894110|ref|YP_076801.1| 292459.STH2974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]