SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6ADS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ADS7
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.0000000000000327
Family ADP-ribosylglycohydrolase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6ADS7
Sequence length 93
Comment (tr|Q6ADS7|Q6ADS7_LEIXX) Uncharacterized protein {ECO:0000313|EMBL:AAT89469.1} KW=Complete proteome; Reference proteome OX=281090 OS=Leifsonia xyli subsp. xyli (strain CTCB07). GN=Lxx17070 OC=Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Leifsonia.
Sequence
MPIALGMLIAAEGGYREAVLGSINYGRDSDSIAVMAGSIAGALGGLAAVPGEWIDGVNEG
SRSVARDVWAADAARAADVAALRTGFAVSLEVA
Download sequence
Identical sequences Q6ADS7
gi|50955286|ref|YP_062574.1| 281090.Lxx17070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]