SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6AGB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6AGB7
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.44e-50
Family Phase 1 flagellin 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6AGB7
Sequence length 290
Comment (tr|Q6AGB7|Q6AGB7_LEIXX) Flagellar hook-associated protein 3 {ECO:0000313|EMBL:AAT88578.1} KW=Complete proteome; Reference proteome OX=281090 OS=Leifsonia xyli subsp. xyli (strain CTCB07). GN=Lxx06190 OC=Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Leifsonia.
Sequence
MTMRVTSTAQLLTTQRNLQAAKASMNDLYQEGTRGVKIAKPSDDPAGVANLLTVRKQLSQ
NAQHTSNVDDGIGWMKTVDSALTGSADVISKIRDLVVQAANTGTSSPANQDSIVKSIEQL
KQNLLALANTQYLGRSVFAGTSDADTAFDVKSYAFNGTPGAEVSRRVSPSATIPVSADGA
AVFGTGSGSVFSLIDGIATKIAADRNVGSELAAIDSALNTISGAQAAIGTNFAQLQLGTD
ATTLEEARSRIEDADPADVVLRLNAQQVSYQTALAVAAKSIQKTLMDYLR
Download sequence
Identical sequences A0A1E2SKE9 Q6AGB7
281090.Lxx06190 gi|50954395|ref|YP_061683.1| WP_011185577.1.68452 WP_011185577.1.84704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]