SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6AJ49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6AJ49
Domain Number 1 Region: 59-204
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.57e-27
Family Penicillin binding protein dimerisation domain 0.0029
Further Details:      
 
Domain Number 2 Region: 171-398
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.000000000000326
Family beta-Lactamase/D-ala carboxypeptidase 0.017
Further Details:      
 
Domain Number 3 Region: 541-594
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000327
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6AJ49
Sequence length 610
Comment (tr|Q6AJ49|Q6AJ49_DESPS) Related to sporulation specific penicillin-binding protein {ECO:0000313|EMBL:CAG37631.1} KW=Complete proteome; Reference proteome OX=177439 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343). GN=DP2902 OC=Desulfobulbaceae; Desulfotalea.
Sequence
MRKSRLRVRKKRGWKKWLFFIMLSILAVAGRECDVRYHLVDRILAAKNQLDGAEGKAFLT
RGNVYDRYNTPLAVNAQRVALFCRTRELENPDTVSRILAKILCIDQETLRARLDSEALRV
WLAEGLSKGQVAEIEAADLQGVYFDRKTVRYYPETSLATHLIGVVEDDVSVSGVECYFDK
LLRGDLEKDYLAISLSGVQDLVLTVDVKSQRLLEKMLQGIAAEGNIERVAAYVVDAKTGG
VLAGAQWPTCNPNEFRKCPQDQRANFFLQPIPVPQSFQNLFADASLLYGSAHEKYFLPWS
VIKTQENIVKENLVWRWLGFGDGWKPDFAASNKVMNGQRDYFTRAETYKNFATPPRNISP
IHLLMGLSSLASGRESIRPHVVEKIVDQQSQESVFFSHSIDFPLDARLTFRLGSKEVKKF
VFSRGGGRRVSSLLLSEAQPVFFEEGRGLVQQELVFALQPSLKRNFAMLLVVERNSAVTK
GRKKSLAGAVDKVLRRIASLQQVFDSLPVVAPLLPEQKFLPFQEGVKEGLVGRTARKERK
AMMPDLMGLSMRKSLQILQDYDCQPLVEGTGWVSSQYPPKGASMEAIKTCRISLQNPDSM
RRKRYAKKRL
Download sequence
Identical sequences Q6AJ49
177439.DP2902 gi|51246754|ref|YP_066638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]