SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6ANT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ANT3
Domain Number 1 Region: 32-241
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.42e-48
Family Voltage-gated potassium channels 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6ANT3
Sequence length 264
Comment (tr|Q6ANT3|Q6ANT3_DESPS) Related to voltage-gated potassium channel {ECO:0000313|EMBL:CAG35991.1} KW=Complete proteome; Reference proteome OX=177439 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343). GN=DP1262 OC=Desulfobulbaceae; Desulfotalea.
Sequence
MGRQSPLSLVSMEKFVEIRIQLRDILENSTTRMSKIIYWVIHCLIITALVSFTVHTLPEL
SPTAKQILYLVDLACLCLFSVEYLLRLFAAENRFRFVCSFFGIVDLLAILPYFLTLGLFD
MRVLRLLRLLQLFKVARYNKVFKRYYRACLLLRVDLAFFLAVALITVYLAAVGIYHFENL
AQPDKFGSIFQSLWWSVVTLTTVGYGDVFPITTGGKVFTFVLLIIGLGLVSVPAGLVASA
LGEAREIEKVEEKGKPEYGETHEQ
Download sequence
Identical sequences Q6ANT3
WP_011188503.1.98904 177439.DP1262 gi|51245114|ref|YP_064998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]