SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6CZG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6CZG6
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 7.32e-39
Family Frataxin-like 0.00000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6CZG6
Sequence length 106
Comment (sp|Q6CZG6|CYAY_PECAS) Iron-sulfur cluster assembly protein CyaY {ECO:0000255|HAMAP-Rule:MF_00142} KW=Complete proteome; Reference proteome OX=218491 OS=carotovora subsp. atroseptica). GN=ECA4185; OC=Pectobacteriaceae; Pectobacterium.
Sequence
MNDSEFHQLADELMLQLEETLDQFEGDADIDSEINGGVMTLSFENGSKIVINRQEPLHQI
WLATKTGGYHFTLREERWVCDRSGEDFIALLSSACSAQAGETVHFE
Download sequence
Identical sequences Q6CZG6
218491.ECA4185 gi|50123105|ref|YP_052272.1| WP_011095656.1.17763 WP_011095656.1.57850 WP_011095656.1.79946 WP_011095656.1.94180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]