SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6DFV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DFV7
Domain Number 1 Region: 117-161
Classification Level Classification E-value
Superfamily LysM domain 0.0000000536
Family LysM domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6DFV7
Sequence length 943
Comment (sp|Q6DFV7|NCOA7_MOUSE) Nuclear receptor coactivator 7 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ncoa7; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDTKEEKKEQKERKQSYFARLKKKKQAKQNAEIVSAASSKSRSGKDDANSDILEQDKFNV
TAEGDHSTDDKKKRKSNQLKEIRRTELKRYYSVDDNQNKTHDKKEKKMMVQKPQGTMEYT
AGSQDTLNSVALKFNVTPNKLVELNKLFTHTIVPGQVLFVPDANISSSTIQLSSSTPGAT
VSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVG
GVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYSDISHMKIKDALPSDL
PRDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGERTLALDAKSVRSPEESTER
TCTRIEPPDNSELWKLKNLQSSRGTTSESPSVTQLSMRAALEPTAKENCLLKGDEDFVDL
EELSSQPESGINKGDATKECLSYDQKKDGPHTVMSAKKGHVQSAQEVMGPESDTELKGAL
DLETAEKQDEAPEVDKHSGSPENLGESTLNIHEDLDKIKLIEFYLNKNKEGSQLLENVQK
SELSDRKSIEPGGIDITLSSSLPQAGDSPPEDNKEPGTLWVKGGETLPLKLDPSAEETVI
NNKEVLDSLGSSLDKMCHSAQMDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCI
KVGKPMRKSFASHTATMVQQYSKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKE
QGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEEEEEEEEGLPILQPH
SALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMD
NQIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGG
RFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences Q6DFV7
ENSMUSP00000066741 NP_766083.3.92730 10090.ENSMUSP00000066741 ENSMUSP00000066741 ENSMUSP00000066741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]