SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6J9S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6J9S1
Domain Number 1 Region: 21-78
Classification Level Classification E-value
Superfamily DNA-binding domain 1.7e-19
Family GCC-box binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6J9S1
Sequence length 253
Comment (sp|Q6J9S1|RA211_ARATH) Protein RELATED TO APETALA2 11 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=T29J13.210; OC=Arabidopsis.
Sequence
MEHQTTPKQKTKEKSKGNKTKFVGVRQRPSGKWVAEIKDTTQKIRMWLGTFETAEEAARA
YDEAACLLRGSNTRTNFANHFPNNSQLSLKIRNLLHQKQSMKQQQQQQHKPVSSLTDCNI
NYISTATSLTTTTTTTTTTAIPLNNVYRPDSSVIGQPETEGLQLPYSWPLVSGFNHQIPL
AQAGGETHGHLNDHYSTDQHLGLAEIERQISASLYAMNGANSYYDNMNAEYAIFDPTDPI
WDLPSLSQLFCPT
Download sequence
Identical sequences Q6J9S1
AT5G19790.1 AT5G19790.1 3702.AT5G19790.1-P NP_197480.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]