SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6KIK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6KIK7
Domain Number 1 Region: 20-170
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-32
Family Prokaryotic PEBP-like proteins 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6KIK7
Sequence length 172
Comment (tr|Q6KIK7|Q6KIK7_MYCMO) Putative phospholipid binding protein {ECO:0000313|EMBL:AAT27569.1} KW=Complete proteome; Reference proteome OX=267748 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711). GN=MMOB0830 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MKIKSNNVKNSILHPDFGGYGNKMDKNQAPSHSLHLEWEEVSGAKSYALEMIDYEASGVV
GFPFIHWVVANIKTNSLEEGASLKNQSILQGVNSRTPKGIVPEAFRAPTIELASQYFGPY
PPDQSHDYVIRIYALNVEKLNLAKNFNLADLHRAIKGHVIDKGKFVFTYLKK
Download sequence
Identical sequences Q6KIK7
gi|47458918|ref|YP_015780.1| WP_011264603.1.31918 267748.MMOB0830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]