SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6LXS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6LXS0
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily GlnB-like 8.89e-27
Family DUF190/COG1993 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6LXS0
Sequence length 109
Comment (tr|Q6LXS0|Q6LXS0_METMP) Uncharacterized protein {ECO:0000313|EMBL:CAF30834.1} KW=Complete proteome; Reference proteome OX=267377 OS=Methanococcus maripaludis (strain S2 / LL). GN=MMP1278 OC=Methanococcaceae; Methanococcus.
Sequence
MKKISAKLLRIYLKEEDKYGKELLINSIIKTLKTNGIAGATVFKGFCGYGTRGISRIDIL
RLSMNLPAVIECIDYEEKLNDIMPKLVEMVSENGLITIQDIDVFKELKK
Download sequence
Identical sequences Q6LXS0
gi|45358841|ref|NP_988398.1| 267377.MMP1278 WP_011171222.1.40991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]