SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6LY30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6LY30
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily GlnB-like 5.19e-26
Family Divalent ion tolerance proteins CutA (CutA1) 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6LY30
Sequence length 104
Comment (tr|Q6LY30|Q6LY30_METMP) CutA1 divalent ion tolerance protein Related Protein {ECO:0000313|EMBL:CAF30719.1} KW=Complete proteome; Reference proteome OX=267377 OS=Methanococcus maripaludis (strain S2 / LL). GN=MMP1163 OC=Methanococcaceae; Methanococcus.
Sequence
MEKPTLVYTTFPNFETAKSIVGYLLEKKMIACANLREHEAHYFNDGDLSINTEIGAFLKT
TENRWISLKDMINEIHPLETPAILKINIDDSNDEFKNWILNIIK
Download sequence
Identical sequences G0H136 Q6LY30
267377.MMP1163 gi|340624483|ref|YP_004742936.1| gi|45358726|ref|NP_988283.1| WP_011171107.1.40991 WP_011171107.1.41672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]