SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6MKS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6MKS8
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.81e-16
Family Clp protease, ClpP subunit 0.051
Further Details:      
 
Domain Number 2 Region: 356-422
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000183
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6MKS8
Sequence length 424
Comment (tr|Q6MKS8|Q6MKS8_BDEBA) Membrane protein necessary for nodulation/competitiveness {ECO:0000313|EMBL:CAE80129.1} KW=Complete proteome; Reference proteome OX=264462 OS=/ HD100). GN=Bd2305 OC=Bdellovibrionaceae; Bdellovibrio.
Sequence
MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKRAVEDKCSSLYLRINT
PGGSLQSTRLIVERILASPVPYLCLIAPRGGHAGSAGAIILQACHVNGGMTATNIGAATP
ILGTGEKTPEDLRKKLINDTVSWMEGVTKLRGRSLKFSKEIITEAKSLSSEVAHAEGALD
ILAATELEFLQQAQGRKVVVGEKKEPSVVAVHDLREFVPDLRYKVLSFIADPEFAYLLFM
GSLALLYVEVTNPGLIAPGVIGGIGLVLSMVAFHKLDVAWGGLALILLGVAFLIAEMFIP
SFGALGIGGLIAVFVGSVFLFDAQTTGYTLPISLIVSVVGVLGIFFLGLGYLAVKTIRLR
TQDTDAQMQSRDGIVMTVEGNGHSGQVEIIGEIWKFVSEDSLAPGDRVHITGRQGLTLNV
KKNK
Download sequence
Identical sequences Q6MKS8
gi|42523756|ref|NP_969136.1| 264462.Bd2305 WP_011164731.1.10133 WP_011164731.1.54414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]