SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6YP21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6YP21
Domain Number 1 Region: 40-449
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.13e-99
Family AAT-like 0.00000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6YP21
Sequence length 454
Comment (sp|Q6YP21|KAT3_HUMAN) Kynurenine--oxoglutarate transaminase III KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KYAT3 OC=Catarrhini; Hominidae; Homo.
Sequence
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Download sequence
Identical sequences B4DW13 Q6YP21
9606.ENSP00000260508 NP_001008661.1.87134 NP_001008661.1.92137 ENSP00000359516 ENSP00000260508 gi|56713254|ref|NP_001008661.1| ENSP00000260508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]