SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q73DJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q73DJ1
Domain Number 1 Region: 387-472
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q73DJ1
Sequence length 483
Comment (tr|Q73DJ1|Q73DJ1_BACC1) Sulfate permease family protein {ECO:0000313|EMBL:AAS39654.1} KW=Complete proteome OX=222523 OS=Bacillus cereus (strain ATCC 10987 / NRS 248). GN=BCE_0721 OC=Bacillus cereus group.
Sequence
MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVGLYAAFCIAVTISFVG
GRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFGVFKLSSFMKFVPKSVM
SGFLNSLGILVFTAQLPHFKNATWQMYALVALGLAIIYVFPRITTAVPSTLISIIIVTSI
ALMSGLQLKTVGDMGSLPKELPFFSMPDVPFTLETLGIILPYAVMLAIIGLLESLLTASV
LDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSVINIKSGGRGRLSTFVAGGF
LIILLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVTTIHKVPKGNAFVMIVTVVVVLI
THNLALGVIIGTVISAVLFAFNMAKIHVKHLYIENKKIYEIHGQLFFASTADLINNFSFE
EDVKEIELNFSHAHIWDDSAVASIDKVIMKYEQSGVKVSIMGLNERSAKLVTNLATYNKR
IAS
Download sequence
Identical sequences A0A150DUW1 A0A1J9XNN0 Q73DJ1
APC64543 GO.9087 WP_000487884.1.24759 WP_000487884.1.39001 WP_000487884.1.45089 WP_000487884.1.49802 WP_000487884.1.65758 WP_000487884.1.79043 WP_000487884.1.92347 gi|42779799|ref|NP_977046.1| 222523.BCE_0721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]