SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q75EI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q75EI1
Domain Number 1 Region: 12-393
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.52e-109
Family IF2B-like 0.00000000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q75EI1
Sequence length 403
Comment (sp|Q75EI1|MTNA_ASHGO) Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein {ECO:0000255|HAMAP-Rule:MF_03119} KW=Complete proteome; Reference proteome OX=284811 OS=Y-1056) (Yeast) (Eremothecium gossypii). GN=AAR098W; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium.
Sequence
MSLQAIQFQRGDKSQVSVRVLDQLLLPYVSRYIPIQTVDDGFAVIRSMQVRGAPAIAIVG
VLSVLVECQLLCNEDFVAVQAFYDLSSYAAFGRTMRMRLAHLLGSRPTAVNLSHALRDVE
RLLDSATSLSQFRDRMYDYACELLDMDVANNVRMGDNGARFLLDALIAEGFDGSFAVLTI
CNTGSLATAGYGTALGAIRSLWQHAEAGLTAPKKQKASACAPRMTHVFPLETRPYNQGSR
LTAYELLHDAIPATLITDSSVAYRIQTSPVPIKAAFVGADRIARNGDTANKIGTLQLALV
CRHFGIRFFVVAPRSTVDGTTAAGTDIPVEERCPDEFRVVTGAAAGATGDPTTASVAIAP
RDMPVWNPAFDVTPHAYIDAIVTETRVFTKDAAGNFDLDELFT
Download sequence
Identical sequences Q75EI1
tr|Q75EI1|Q75EI1_ASHGO NP_982639.1.49492 33169.AGOS_AAR098W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]