SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7AJZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7AJZ5
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily AF1862-like 6.41e-25
Family Cas Cmr5-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7AJZ5
Sequence length 125
Comment (tr|Q7AJZ5|Q7AJZ5_BACHD) BH0331 protein {ECO:0000313|EMBL:BAB04050.1} KW=Complete proteome; Reference proteome OX=272558 OS=9153 / C-125). GN=BH0331 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKSLDAHYANIALQSIQELEKSDEAFKTSFGSLCHQFPSMVRLNGLRLTVAFYESKKENT
AHARYLAGLKAALGVSISANDIPERGAEYRRMTEQALRASIWFKRYAEAILKCSPTSEPV
REGDV
Download sequence
Identical sequences Q7AJZ5 Q9RC62
WP_010896512.1.28103 gi|15612894|ref|NP_241197.1| 272558.BH0331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]