SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7K3B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7K3B7
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.62e-44
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000391
Further Details:      
 
Domain Number 2 Region: 361-557
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-43
Family Pyruvate oxidase and decarboxylase PP module 0.0000288
Further Details:      
 
Domain Number 3 Region: 188-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.42e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7K3B7
Sequence length 568
Comment (tr|Q7K3B7|Q7K3B7_DROME) LD40177p {ECO:0000313|EMBL:AAL13912.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG11208 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAEVEAVQIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAI
GYLTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVEL
SRPYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAH
PAPPLAYPPHDDVIRAAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMG
KGVVSDTAPQCVSSARTLALQKADVVLLLGARLNWILHFGKAPRYDKDVKFIQVDINPEE
LHNSVVASVAIQADIRPFAEQLFEQMNAVNFRFGYEQDWWKQLAVKCKQNRDTVQKMSLN
TETPLNYYAVFHHLRELLPKDTIIVSEGANTMDIGRSMLLNEQPRHRLDAGTFGTMGVGP
GFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVIVNNNGIYGGFD
KDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKMFGMKGYFCTEIEQLQAAVKAANQLTD
RPTIINVAISPSSDRKPQSFNWLTESKL
Download sequence
Identical sequences Q7K3B7
FBpp0085630 7302414___KOG1185 FBpp0085630 FBpp0085630 NP_611460.1.81976 7227.FBpp0085630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]