SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MDL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MDL0
Domain Number 1 Region: 3-211,311-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.51e-49
Family FAD-linked reductases, N-terminal domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 212-310
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.53e-32
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.0000544
Further Details:      
 
Domain Number 3 Region: 456-555
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.35e-26
Family ETF-QO domain-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7MDL0
Sequence length 555
Comment (tr|Q7MDL0|Q7MDL0_VIBVY) Electron transfer flavoprotein-ubiquinone oxidoreductase {ECO:0000313|EMBL:BAC97052.1} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=VVA1026 OC=Vibrionaceae; Vibrio.
Sequence
MERECMEFDVVIVGAGPAGLSAACRLAQLAQASNQSLSICVLEKGSEVGAHILSGALFET
RALAELFPDWQDQAAPVDTPITQDRLLYLTTEHNHIEVPAFLVPKSLHNSSDNYVISLGN
LCRWLAKQAEALGVEVFAGFPAKEVVINESDIVTGVITTDMGLDKQSQPKAGFEAGIELK
ARFTVFAEGARGHLGKQLIEHFALDQGKPPQHYALGIKEIWQLPQENPAYQAGHVTHFAG
WPLSDTDSQGGGFLYHLDNHQVCVGLITDLNYSNPYLSPFEEFQRMKHHPAIASLLQGAE
RVAYGARAITKGGLHSLPKQQFAGGLLIGCDAGTLNSGKIKGCHTAMKSGMLAAEAIFKA
WQSPEQNTEADYQSEFEHSWLYDELAQTKNFSAALHRYGPLVGGALNTFEQNLWYPLTGQ
APSWHIVDDRADHLCLDECAVVTPIVYPKADGVLSFDKPSSLYLSATQHEENQPCHLMVN
DLDTALKRHLNLYDEPAQRYCPAGVYEVIEGESGPYLQINAANCLHCKTCDIKDPSGNIT
WTPPEGGGGPNYQNM
Download sequence
Identical sequences Q7MDL0
WP_011152310.1.34622 gi|37676686|ref|NP_937082.1| 196600.VVA1026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]