SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MHE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MHE7
Domain Number 1 Region: 7-221
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.76e-62
Family Pseudouridine synthase RsuA/RluD 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7MHE7
Sequence length 250
Comment (tr|Q7MHE7|Q7MHE7_VIBVY) Pseudouridylate synthase {ECO:0000313|EMBL:BAC95688.1} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=VV2924 OC=Vibrionaceae; Vibrio.
Sequence
MAMLEYLPPTDPWTEIIFEDDHILAVNKPSGLLSVPGRLPEHHDSMWSRLQEQYPEIQVV
HRLDMSTSGLMVFAKNKRAEAALKKQFQYRLTHKIYYARVWGHVETDSGMIDLPLICDWP
NRPMQKVCHEHGKPSQTEFQVAKREVHANGAQTTIMRLLPVTGRSHQLRVHMQALGHPIV
GDEFYAQGDAFTFSERLELHAAELSFYHPKSHWLRSLFVPCDFYPDAEEMIFSYFDPARK
LPDYKSLPKS
Download sequence
Identical sequences Q7MHE7
gi|37681108|ref|NP_935717.1| 196600.VV2924 WP_011151233.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]