SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MI80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MI80
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.51e-65
Family GHMP Kinase, N-terminal domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 206-382
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.88e-53
Family Galactokinase 0.000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7MI80
Sequence length 386
Comment (sp|Q7MI80|GAL1_VIBVY) Galactose kinase {ECO:0000255|HAMAP-Rule:MF_00246} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=galK OC=Vibrionaceae; Vibrio.
Sequence
MSELIQNVKTSFEQVLGYAPSHIIQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKR
EDNLVRVVSVDYGNAVDEFDITQAITFQQDKMWANYIRGVVKCLLARGYAFTGADISVSG
NVPQGAGLSSSAALEVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISA
EGRENHAMLLDCRSLETESVSMPEEMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGV
KALRDVTIEQFNEKVAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHA
SMRDDFEITVKEIDTLVEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKATVAAK
YQAATGLKESIYVCQAKDGAGLVEML
Download sequence
Identical sequences Q7MI80
196600.VV2637 WP_011151024.1.21633 WP_011151024.1.22778 WP_011151024.1.34622 WP_011151024.1.9921 gi|37680821|ref|NP_935430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]