SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MLM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MLM4
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.5e-44
Family Pseudouridine synthase RsuA/RluD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7MLM4
Sequence length 231
Comment (tr|Q7MLM4|Q7MLM4_VIBVY) Pseudouridylate synthase, 23S RNA-specific {ECO:0000313|EMBL:BAC94167.1} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=VV1403 OC=Vibrionaceae; Vibrio.
Sequence
MFDILFTHPDFLIINKYPHVSVHKDDGDTMLLQEVAKVSGDEQLYLIHRLDKMTSGILLL
GRNSTAASALSQRFAQREVEKFYLAIGAKKPKKKQGTVIGDMERSRRASWKLVNSKQNPA
ITQFFSLAGEPGERAFLCKPYTGKTHQIRVALKSVGSSIIGDPIYNAGSDSDRGYLHAFC
LGFQYQGEQYHFVCDPRNQPALGEKWNSEALNQAIEQWLTPWQLNWPTINK
Download sequence
Identical sequences Q7MLM4
gi|37679587|ref|NP_934196.1| 196600.VV1403 WP_011150063.1.16238 WP_011150063.1.34622 WP_011150063.1.93668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]