SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MM05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MM05
Domain Number 1 Region: 96-312
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.72e-65
Family Pseudouridine synthase RsuA/RluD 0.000000089
Further Details:      
 
Domain Number 2 Region: 19-71
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000379
Family Ribosomal protein S4 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7MM05
Sequence length 315
Comment (tr|Q7MM05|Q7MM05_VIBVY) Pseudouridine synthase {ECO:0000256|RuleBase:RU362028} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=VV1267 OC=Vibrionaceae; Vibrio.
Sequence
MNEIRTKVQIVDIDEDMAGQRIDNFLRNQLKDVPKSMIYRIVRKGEVRVNKKRVKAEYKL
AAGDIVRIPPVTLEKKDPETAPSTKLNKVAELQDLIIYEDDHLLVLNKPSGTAVHGGSGL
KFGAIEALRALRPEARFLELVHRIDRDTSGILLVAKKRSALRHLQAQFREKTVQKYYFAL
VMGEWENSCKVVNAPLLKNEVNSIVRVNPNGKPSETRFKVIEKFPQATLVQASPITGRTH
QIRVHTQYSGHPIAWDDRYGDRRFDAYTAQHGLNRLFLHAANIRFTHPATEQIMEINAPM
GELLEKVVQSLRTSR
Download sequence
Identical sequences Q7MM05
196600.VV1267 gi|37679452|ref|NP_934061.1| WP_011149965.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]