SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MYN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MYN3
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.19e-39
Family Frataxin-like 0.00000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7MYN3
Sequence length 106
Comment (sp|Q7MYN3|CYAY_PHOLL) Iron-sulfur cluster assembly protein CyaY {ECO:0000255|HAMAP-Rule:MF_00142} KW=Complete proteome; Reference proteome OX=243265 OS=105565 / TT01). GN=plu4642; OC=Morganellaceae; Photorhabdus.
Sequence
MNDSEFHQLADQLILYIEGQLDNYDGNADIDCETNGGVMTLSFDNDSKIIINRQEPFHQI
WLATKGGGYHFDYKEGQWICDRSGDNFLTMLAYAITEQSGEQFSFP
Download sequence
Identical sequences Q7MYN3
243265.plu4642 gi|37528459|ref|NP_931804.1| WP_011148713.1.100813 WP_011148713.1.49830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]