SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7NCB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NCB9
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.11e-19
Family Ribosomal protein L33p 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NCB9
Sequence length 63
Comment (sp|Q7NCB9|RL33_GLOVI) 50S ribosomal protein L33 {ECO:0000255|HAMAP-Rule:MF_00294} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gsl3060; OC=Gloeobacteraceae; Gloeobacter.
Sequence
MAKPGARIIITLECTECRTNTAKRRPGVSRYTTTKNKRNTTGRMELKKFCPNCNKHTVHK
ETK
Download sequence
Identical sequences Q7NCB9
gi|37522629|ref|NP_926006.1| NP_926006.1.44878 251221.gvip419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]