SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NCV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NCV6
Domain Number 1 Region: 74-127
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000107
Family GSPII protein E N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7NCV6
Sequence length 131
Comment (tr|Q7NCV6|Q7NCV6_GLOVI) Gll2870 protein {ECO:0000313|EMBL:BAC90811.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll2870 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MNPSGPDGRTHHDNSKFPNAAVPPSPPGVTHAPVSDGLSLAHPHPNRAPRPALDRYGADG
AERPRTLPHLLRPAMYPAIDDYLIGRGLVSERQLRRARELAQLWQGTVPVVLWKLGWIDL
NTFAVLLEYSS
Download sequence
Identical sequences Q7NCV6
251221.gll2870 NP_925816.1.44878 gi|37522439|ref|NP_925816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]