SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7NGV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NGV3
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.09e-48
Family Ribosomal protein L20 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7NGV3
Sequence length 119
Comment (sp|Q7NGV3|RL20_GLOVI) 50S ribosomal protein L20 {ECO:0000255|HAMAP-Rule:MF_00382} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll2784; OC=Gloeobacteraceae; Gloeobacter.
Sequence
MVRVKRGNVARKRRKKILKLAKGFRGSHSKLFTAANQQVMKALRNAYRHRRTKKRDFRSL
WIVRINAQARTEGLSYSRLIDGLHKADVALNRKMLAQLAVTDPEAFAEVARVAKSARPV
Download sequence
Identical sequences Q7NGV3
gi|37522353|ref|NP_925730.1| NP_925730.1.44878 251221.gvip383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]