SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7NIM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NIM6
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily RbcX-like 1.31e-41
Family RbcX-like 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NIM6
Sequence length 125
Comment (tr|Q7NIM6|Q7NIM6_GLOVI) RbcX protein {ECO:0000313|EMBL:BAC90098.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=rbcX OC=Gloeobacteraceae; Gloeobacter.
Sequence
MDLKAITKATAKVLVSYLTYQAVRVVLDQLRETDPQRAIWFNQFSTAKTLQDGEAYLREL
VAVDPALAMRVMTVREHLAEQVADFLPELVRTGVQQSNMDHRRQYIERTLQLESPAESEA
ETPND
Download sequence
Identical sequences Q7NIM6
251221.gvip296 gi|37521726|ref|NP_925103.1| NP_925103.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]