SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7NKV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NKV3
Domain Number 1 Region: 16-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-130
Family Cystathionine synthase-like 0.00000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7NKV3
Sequence length 417
Comment (tr|Q7NKV3|Q7NKV3_GLOVI) Cysteine desulfurase {ECO:0000256|RuleBase:RU004506, ECO:0000256|SAAS:SAAS00645443} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr1373 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MTFTAQAHRTLTPAAVERLRADFPILRQTVYGKPLVYLDNAATTQKPQAVLDAIAALYTG
YYSNIHRGVHHLSQLSTEAHEQARIKVQQFINAQSDREIVFVRGCTEGINLVAQTFGRER
VGPGDEIVISAMEHHSNIVPWQMLCQEKGAILKVAPIDDRGEIILEAFEQLLGERTKLVA
VVHLSNALGTINPVARLIELAHTRGIPVLVDGAQAVSHIAVDVQALDCDFYVFSGHKLYA
PTGIGVLYGKAELLEAMSPWQGGGDMIRSVSFEKTIYSDLPYKFEAGTPDIAGAIALGVA
VDYVQHIGLEAIAGYEQELLDYATEALSAIDGVKLIGTARDKASVLSFVLAGVHPHDIGT
ILDRKGIAVRAGHHCAQPVMQRFKVPATARASFAFYNTRAEVDALVAAIQQVQEMFS
Download sequence
Identical sequences Q7NKV3
gi|37520942|ref|NP_924319.1| NP_924319.1.44878 251221.glr1373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]