SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7QGJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7QGJ7
Domain Number 1 Region: 10-133
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.15e-35
Family Insect phospholipase A2 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7QGJ7
Sequence length 137
Comment (tr|Q7QGJ7|Q7QGJ7_ANOGA) AGAP011569-PA {ECO:0000313|EMBL:EAA05678.3} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP011569 OC=Culicidae; Anophelinae; Anopheles.
Sequence
HKRAISDWFLSPNTKWCGKGHSASEYRQLGGASRADMCCRTHDHCKYMIPPMSTNFQTFN
IRPFTISHCACDSRFRTCLKLADSKDANLVGKLFFNVMQMKCFVFKPETVCTKKSWWGTC
ERKGRRKRAVLRHNRKF
Download sequence
Identical sequences Q7QGJ7
AGAP011569-PA|hypothetical 7165.AGAP011569-PA XP_309938.3.40869 AGAP011569-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]