SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7UKD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7UKD4
Domain Number 1 Region: 460-910
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-28
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 831-1122
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000000165
Family YVTN repeat 0.041
Further Details:      
 
Weak hits

Sequence:  Q7UKD4
Domain Number - Region: 12-66
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0942
Family GSPII protein E N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7UKD4
Sequence length 1129
Comment (tr|Q7UKD4|Q7UKD4_RHOBA) Similar to serine/threonine protein kinase related protein-putative PQQ-dependent oxidoreductase {ECO:0000313|EMBL:CAD76947.1} KW=Complete proteome; Reference proteome OX=243090 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1). GN=RB10706 OC=Planctomycetaceae; Rhodopirellula.
Sequence
MVGGFTFINMLANELIDQLERRGLLDQEIIEALREQMSQGGSRVTPEAVAKLLVDNGQLT
RFQATKLIGELRSESYDSEAAEVIEGEEDLTAQLIDDEEVAEAVIEDDDPFGDNPVEVEA
IEAEPVEVVAEAEVMGDAMDGAPSRGRPSARVKKPETKSTWDSFKIYGYLGIIGFLIIAG
GVLWFVLSKGNADEFIALANKQYDSQSYQPAQDAYIAYLDQFGENSQYSSLARTRITMCE
LFRAEQMTDPVAGLEMAKEKLPTIINEEAMNDERGNLAGFLVDVAENIAREAEAAKETEE
KRRLLERLDEQQTLIDNPNYMLSTMKTTLSGRLLQLSEARNRVKREIDRNVRLDATEAAM
QSALAEKKTKEAYDERDSLLRDFPELAKDPRLVTLIEEASDIQQTLVKPSAKTPKITNEP
ASDAAVKSIVLTTRQGDSIPGVEEEVFFLRAGGSVLAFAVDDGRLLWRDYTGQGEDYTPL
RLDDGTAVLLSDMANDEIRRCRGEDGEVEWRAKFGEPFVEPVSGRDSILVTMDSGTLVSL
DSDSGDVKWSTDLSQELSTPAGLDDTLNRIYIPGSHSNLYVLNARDGKCIESLYLEHDEG
TIAVAPVSLLGHVFVIENAGSDYAQVHVLKVDENGENIKIAQSPFRLDGNVVVPPIVQNR
RLIVLTDRGQVAVYDIEPTSEKEQVSLIAQQVAAYDKPTLTRMAVGRSQMWITGTRIGRY
ELQINTGRVVYDWGKNEGDTFIGQPLSLEDVLVHARVLKGTSAIRVTAAEPKTGRELWRT
DVGTPIAMITRAPESGFHAVTSQGALFELTAESLSEGSTQGPIENPGANGISMSFQNPIV
VDDVRRMLLNQSQKGEALIYDPTRRSEKLRKVTFQLTGPKPTGVATFSGGGLFLPLDTGR
AVLMDWQTGSVKGAPFQPASDPTATVQWTNPIKSAADPDQVLIADSRKKLYRLRVGDQIR
ELSSVDLESPFLGTVAGIESSLLGSVSGPASDYLVGHDQTGLEQTFKKVLDGRIVWGPIA
APSDSNGEIALLITDDQVLRGFSASGEPLFQTQMPEGGLLVDQVVSTGGRWVLTGKDGWL
TAVDPASGNVVGTTLLGQPLSAGPLPVGDKLLVPGTEGVVYITNIPGDA
Download sequence
Identical sequences Q7UKD4
243090.RB10706 gi|32476575|ref|NP_869569.1| NP_869569.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]