SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7V6G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7V6G7
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily YjgF-like 5.65e-44
Family YjgF/L-PSP 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7V6G7
Sequence length 142
Comment (tr|Q7V6G7|Q7V6G7_PROMM) Uncharacterized protein {ECO:0000313|EMBL:CAE21370.1} KW=Complete proteome; Reference proteome OX=74547 OS=Prochlorococcus marinus (strain MIT 9313). GN=PMT_1195 OC=Prochlorococcus.
Sequence
MMQHSCSEQTMNAPSVQAITTASAPAPVGPYNQAVLAGGWLYCSGQIALDPTNGVMVGQG
DVEAETRQVLSNLMAVLTAAGAEPRQVIRTTVYLTDLADFQRVNALYGEIFGDGISPARA
CVQVAALPKGGRVEIDCVAWLG
Download sequence
Identical sequences Q7V6G7
gi|33863465|ref|NP_895025.1| 74547.PMT1195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]