SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7WAN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7WAN8
Domain Number 1 Region: 450-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7WAN8
Sequence length 563
Comment (tr|Q7WAN8|Q7WAN8_BORPA) Putative sulfate transporter {ECO:0000313|EMBL:CAE36638.1} KW=Complete proteome OX=257311 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253). GN=BPP1336 OC=Alcaligenaceae; Bordetella.
Sequence
MPHSVACLDLRVIALLEAKRAGLLRRAHWLPNIVSGLIVGVVALPLAMAFAIASGAKPEQ
GLYTAIVAGLLVSLCGGSRVQIAGPTGAFIVILAGITAQHGVAGLQLATLMAGCILLALG
AARLGAIIKYIPAPVIVGFTAGIGVIIWVGQWKDFFGLPSPAGTHFHEKLWQLVHSLPQL
HLATTALAALSLALLLLNNRLPYLRRVPGPLVALVVATTLQAVLGLDGVATIGSAFGGIP
QGLPSWQWPEITVSRVIELIGPAFAIAMLGAIESLLSAVVADGMAGTRHDSNQELVGQGL
ANIVAPLFGGFAATGAIARTATSIRNGGTSPLAGVVHCITLLLMVLLLAPLAENVPLAAL
AAILFVVAWNMSDAPHFVRMIKRAPRADVAILLVTFVLTVFADLVVAVNIGVVIAILHFL
RRMASSVQVQAQSPAELGDELGHRGYGPLPDDVLVYAVEGPLFFGAAENFERALAATHTD
PRTLIIRLRWVPFIDITGLQALEEVITDLQRRGVRVILSGANPRVKAKLHRAGLVGLAGA
DNVFDRFEDAVLSCRAPAAPATA
Download sequence
Identical sequences A0A2J9U0Z0 Q7WAN8
WP_010927986.1.23657 WP_010927986.1.26498 257311.BPP1336 GO.9075 gi|33595996|ref|NP_883639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]