SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7ZTT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7ZTT0
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily Histone-fold 7.3e-43
Family Nucleosome core histones 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7ZTT0
Sequence length 140
Comment (tr|Q7ZTT0|Q7ZTT0_DANRE) Histone H2A {ECO:0000256|RuleBase:RU003767} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=LOC100332229 OC=Cyprinidae; Danio.
Sequence
MSGRGKKLAAPQKSKTSVSRSARAGLQFPVGRIARLLRKGNFAARIGSGAAVYLTAVIEY
LCAEVLELAGNASRDNKKLRIAPRHIQLAVRNDEELNTLLGGVTISEGGVLPNIQAVLLP
KKTKAAREPNAGTEAQSQDF
Download sequence
Identical sequences Q7ZTT0
ENSDARP00000012454 7955.ENSDARP00000012454 XP_002660369.1.45394 ENSDARP00000012454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]