SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q80VQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q80VQ0
Domain Number 1 Region: 6-436
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-125
Family ALDH-like 0.000000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q80VQ0
Sequence length 468
Comment (sp|Q80VQ0|AL3B1_MOUSE) Aldehyde dehydrogenase 7 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh3b1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFEAE
VSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPINL
TLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQLLEHK
FDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQIVANRVAWFRYFNA
GQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC
GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFMNRREK
PLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFD
TFSNQRACLLRSPGMEKINDLRYPPYSSRNLRVLLVAMEERCCSCTLL
Download sequence
Identical sequences Q3TX25 Q80VQ0
10090.ENSMUSP00000056276 ENSMUSP00000056276 NP_080592.2.92730 XP_006531893.1.92730 ENSMUSP00000056276 ENSMUSP00000056276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]