SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q86SJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86SJ2
Domain Number 1 Region: 41-272
Classification Level Classification E-value
Superfamily L domain-like 1.77e-36
Family Ngr ectodomain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 299-379
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000105
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q86SJ2
Sequence length 522
Comment (sp|Q86SJ2|AMGO2_HUMAN) Differentially expressed in gastric adenocarcinomas KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALI1 OC=Catarrhini; Hominidae; Homo.
Sequence
MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLS
KVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLK
CLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQF
PMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDCSLYSLL
VFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHEA
QVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGV
YSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQN
GKVRLFPSEAVIAEGILKSTRGKSDSDSVNSVFSDTPFVAST
Download sequence
Identical sequences A0A024R127 A0A2I2ZSR1 H2Q5S1 Q86SJ2
gi|219521831|ref|NP_001137140.1| gi|32469517|ref|NP_862830.1| NP_001137140.1.87134 NP_001137140.1.92137 NP_862830.1.87134 NP_862830.1.92137 XP_001163356.1.37143 XP_003825815.1.60992 XP_004053055.1.27298 XP_004053056.1.27298 XP_005268894.1.92137 XP_008949348.1.60992 XP_009423801.1.37143 XP_018894846.1.27298 XP_522364.1.37143 ENSGGOP00000026086 9598.ENSPTRP00000008307 9606.ENSP00000266581 ENSPTRP00000008307 NYSGRC-IgSF-AMGO2_HUMAN ENSPTRP00000008307 ENSP00000266581 ENSP00000320848 ENSP00000406020 ENSP00000449034 ENSP00000266581 ENSP00000266581 ENSP00000406020 ENSP00000449034 ENSGGOP00000026086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]