SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q86VV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86VV4
Domain Number 1 Region: 281-411
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-34
Family Ran-binding domain 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q86VV4
Sequence length 465
Comment (sp|Q86VV4|RNB3L_HUMAN) Ran-binding protein 3-like KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RANBP3L; OC=Catarrhini; Hominidae; Homo.
Sequence
MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEA
AEPECNGFPTKRVRSSSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSK
HVIRPAILQLPQARSCAKVRKTFGHKALESCKTKEKTNNKISEGNSYLLSENLSRARISV
QLSTNQDFLGATSVGCQPNEDKCSFKSCSSNFVFGENMVERVLGTQKLTQPQLENDSYAK
EKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSRKCLLEKIDVITGEETEHNVL
KINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLRLILNSKLWAQ
MKIQRANHKNVRITATDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQ
AESLSETAQQLNCESCDENEDDFIQVTKNGSDPSSWTHRQSVACS
Download sequence
Identical sequences Q86VV4
ENSP00000296604 gi|239582743|ref|NP_659437.3| 9606.ENSP00000296604 ENSP00000296604 NP_659437.3.87134 NP_659437.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]