SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q86Y79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86Y79
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.24e-46
Family Peptidyl-tRNA hydrolase-like 0.0000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q86Y79
Sequence length 214
Comment (sp|Q86Y79|PTH_HUMAN) Probable peptidyl-tRNA hydrolase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PTRH1; OC=Catarrhini; Hominidae; Homo.
Sequence
MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCF
SPAEQELLPLLLDRATDLILDHIRERSQGPSLGP
Download sequence
Identical sequences A0A2I3RMH2 Q86Y79
gi|50897284|ref|NP_001002913.1| ENSPTRP00000048917 ENSP00000418661 ENSP00000439469 ENSP00000418661 ENSP00000418661 ENSP00000439469 ENSPTRP00000048917 9598.ENSPTRP00000048917 9606.ENSP00000418661 NP_001002913.1.87134 NP_001002913.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]