SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q888N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q888N6
Domain Number 1 Region: 370-571
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.23e-68
Family Pyruvate oxidase and decarboxylase PP module 0.0000151
Further Details:      
 
Domain Number 2 Region: 3-179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.22e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000501
Further Details:      
 
Domain Number 3 Region: 189-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.26e-63
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q888N6
Sequence length 574
Comment (tr|Q888N6|Q888N6_PSESM) Acetolactate synthase {ECO:0000256|RuleBase:RU003591} KW=Complete proteome; Reference proteome OX=223283 OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000). GN=PSPTO_0981 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MELLSGAEMIVRFLRDEGVEHIYGYPGGALLHVYDALFKEPAVSHILVRHEQAATHMADG
YARATGKAGVVLVTSGPGATNAITGIATAYMDSIPMVVLSGQVASTLVGTDAFQETDMIG
ISRPIVKHSFMIKHPSEIPEILKKAFYLAQSGRPGPVVVDIPKDMTNPAEKFEYVFPKKA
KLRSYSPAVRGHSGQIRKAVEMLLAAKRPIIYAGGGVIMGNASAQLTELAQLLNAPVTNT
LMGLGCYPGTDRQFVGMLGMHGSYTANLAMHHTDVILAVGARFDDRVINGASKFCPNAKI
IHIDIDPASISKTIKADVPIVGPVESVLTEMVATLKEIGETPDKASVAAWWKQIDEWRGS
GDLFPYNRGDGTVIKPQAVIETLCEVTKGDAYVTSDVGQHQMFAAQYYRFNKPNRWINSG
GLGTMGFGFPAAMGVKLSFPDEHVACVTGEGSIQMNIQELSTCLQYGLPVKIILLNNGVL
GMVRQWQDMSYGARHSHSYMESLPDFVKLVEAYGHVGMRITDLKDLKPKMEEAFAMTDRL
VFLDIQVDVSEHVYPMQIKDGSMRDMWLSKTERT
Download sequence
Identical sequences A0A099SS56 A0A0N0WU09 A0A0Q0IDW9 Q888N6
223283.PSPTO_0981 NP_790820.1.37326 WP_007246092.1.11497 WP_007246092.1.12126 WP_007246092.1.14276 WP_007246092.1.14773 WP_007246092.1.14805 WP_007246092.1.17870 WP_007246092.1.26792 WP_007246092.1.28009 WP_007246092.1.36896 WP_007246092.1.41250 WP_007246092.1.45653 WP_007246092.1.49996 WP_007246092.1.58347 WP_007246092.1.60779 WP_007246092.1.60793 WP_007246092.1.62491 WP_007246092.1.64333 WP_007246092.1.6959 WP_007246092.1.71514 WP_007246092.1.7265 WP_007246092.1.80269 WP_007246092.1.83999 WP_007246092.1.87092 WP_007246092.1.99297 gi|28868201|ref|NP_790820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]