SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q88IW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q88IW3
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.42e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q88IW3
Sequence length 177
Comment (tr|Q88IW3|Q88IW3_PSEPK) Putative Cytochrome b561 {ECO:0000313|EMBL:AAN68494.1} KW=Complete proteome; Reference proteome OX=160488 OS=KT2440). GN=PP_2886 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKPQAFHPFARLLHWLMAVLILAMLFIGVSMVPDLSLRHPVLISLHKATGLALLVLVVLR
IAVRLTLPHPPLPNDLPKLQRWAAGASHLLLYGLMLAMPLLGWAMLSAGDYPRPLGLPAI
APHNLQLYAVLRQAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLHRSE
Download sequence
Identical sequences Q88IW3
160488.PP_2886 NP_745030.1.35174 WP_010953790.1.28295 WP_010953790.1.28475 WP_010953790.1.3142 WP_010953790.1.58218 WP_010953790.1.71439 WP_010953790.1.87606 GO.819 GO.8579 gi|26989605|ref|NP_745030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]