SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q897Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q897Q1
Domain Number 1 Region: 89-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000418
Family NfeD domain-like 0.0069
Further Details:      
 
Weak hits

Sequence:  Q897Q1
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00209
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q897Q1
Sequence length 146
Comment (tr|Q897Q1|Q897Q1_CLOTE) Conserved protein {ECO:0000313|EMBL:AAO35285.1} KW=Complete proteome; Reference proteome OX=212717 OS=Clostridium tetani (strain Massachusetts / E88). GN=CTC_00680 OC=Clostridium.
Sequence
MYSQILLWIVIGATAITVDIFTSSFLFVWFTIGSIVALIISSLGYSFSVQFIAFIFTSVV
LLAVGYPIVRKTIKKSVPKTLPMGQNYINRIITVEKDIKEEELIKIDGIYWTVLNEGKLI
KKGEKAKIIALNGNKFILKKYEEDAK
Download sequence
Identical sequences A0A1T4QQ28 Q897Q1
212717.CTC00680 gi|28210404|ref|NP_781348.1| WP_011098951.1.12609 WP_011098951.1.27827 WP_011098951.1.49058 WP_011098951.1.52649 WP_011098951.1.71400 WP_011098951.1.81004 WP_011098951.1.83101 WP_011098951.1.84243 WP_011098951.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]