SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q89P69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q89P69
Domain Number 1 Region: 34-383
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.07e-90
Family L-arabinose binding protein-like 0.0000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q89P69
Sequence length 394
Comment (tr|Q89P69|Q89P69_BRADU) ABC transporter substrate-binding protein {ECO:0000313|EMBL:BAC48879.1} KW=Complete proteome; Reference proteome OX=224911 OS=14792 / USDA 110). GN=blr3614 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MTIELSRRGFCMGTALIGLQAVSSSAFARTEDGTVKLGLVAPMSGPNARYGAFSLRGAQM
AAKEINGAGGIGGRKINVLAGDSQGTPVEGVSATRRLIDQDQVDFIIGDVSSSVTLAMQP
VVEDAGVLLLNAASSNPKITYKAGVGGFKWTYRNYPTDENRALIVLQYAAEKKGFTKYAV
LSVDSDYGRAAIEFTKKYLPRFKSQILTEDYYKEGEVDFRSVLSKIRDSGAQAIIMYGNA
DSTPIVGRQMMEVGIAGKIPLIGNAEFNTEKTIKAAPKALEGAIEAAAWLPAYEPEKSKA
FVDKFTAEFREAPNNHAYVHWETTHLLAKAIEQAQSIDREKVRTALSKIHYASAVGEVTF
DDHNQARLPMILLEIENGKPAIKGAYSAEIDYPK
Download sequence
Identical sequences A0A2A6N069 Q89P69
NP_770254.1.11505 WP_011086395.1.15658 WP_011086395.1.90507 224911.blr3614 gi|27378725|ref|NP_770254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]