SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8BGK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BGK2
Domain Number 1 Region: 1-350
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 8.63e-72
Family ADP-ribosylglycohydrolase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8BGK2
Sequence length 353
Comment (sp|Q8BGK2|ARHL1_MOUSE) ADP-ribosylhydrolase 2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Adprhl1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEKFKAAMLLGSVGDALGYGNICRENSVLGSIQEELQKTGGLDSLVLSPGRWPVSDNTIM
HMATAEALTTDYWCLDDLYREMVKRYVETVETLSEHRPDPSTIEGCSQLKPDNYLLAWHT
PFSEKGSGFGAATKAMCIGMRYWKPERLETLIEVSIECGRMTHNHPTGFLGSLCTALFAS
YALQGKPLVQWGREMLKVLPLAEEYCRKTIRHMAEYQEHWFYFEAKWQFYLEERKIREDA
EDKVTFPDNYDAEERDKTYKKWSSEGRGGRRGHDAPMIAYDALLASGSNWTELCQRAMFH
GGESGATGTIAGCLFGLLHGLATVPRGLYQELEHKGRLEDLGAALHRLSTEEK
Download sequence
Identical sequences Q8BGK2
ENSMUSP00000033825 ENSMUSP00000033825 10090.ENSMUSP00000033825 NP_766338.1.92730 ENSMUSP00000033825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]