SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8CGE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8CGE9
Domain Number 1 Region: 691-838
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-30
Family Ras-binding domain, RBD 0.00084
Further Details:      
 
Domain Number 3 Region: 227-362
Classification Level Classification E-value
Superfamily PH domain-like 2.99e-23
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 
Domain Number 4 Region: 9-98
Classification Level Classification E-value
Superfamily PDZ domain-like 1.3e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-16
Family Ras-binding domain, RBD 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8CGE9
Sequence length 1381
Comment (sp|Q8CGE9|RGS12_MOUSE) Regulator of G-protein signaling 12 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rgs12; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MYRAGEPGKRQPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAG
DQILAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSHVESCSSDEEGGLYEGKGWLR
PKLDSKALGINRAERVVEEVQSGGIFNMIFESSSLCASGPEPLKLKQRSLSESAALRLDA
GQAGLCAPHPSMLSKEDISKVINDDSVFTVGLDSHDDFGLDASILNVAMVVGYLGSIELP
STSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDCVQLVTDRAGVVAEYPAEKLAF
SAVCPDDRRFFGLVTMQTNDDGGLAQEDEGALRTSCHVFMVDPDLFHHKIHQGIARRFGF
ACTADPDTSGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFLDGDADAHQNNSTSSN
SDSGIGNFNQEEKSNRVLVVDLGGGSSRHGQGSSPGWESGGGRGSQPWSAPWNGAFCHDS
EAGSPLETSPNTDRFWDLTKHSGPVSHMEVPPATLRSSIPPSKRGAAGSSCGFNQRWLPV
HVLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQAPLSTQKR
DWSRKAFGMQNLFGPHRNVRKTKEDKKSSKLGRGVALAQTSQRTSARRSFGRSRRFSITR
SLDDLESATVSDGELTGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACECFSHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECVLAEVEGRT
LPDSQQVPSSPASKHSISSDHSNVSTPKKLSGKSKSGRSLNEDVGEEDSEKKRRGAFFSW
SRSRSTGRSQKKKDHGDHAHDAPHANGGLCRRESQGSVSSAGSLDLSEACRTSALEKDKA
AKHCCVHLPDGTSCVVAVKSGFSIKEILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILATRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSG
EKEPLDLGAPISSLDGQRVILEERDPSRGKVSTDKQKGAPVKQNSAVNSSPRNHLAMGEE
RTLGKSNSIKIRGENGKSARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPAGSSELALSSPPPVKGYSKRAVTGHGQEGAAQTEESY
SDSPATSPASAQSPCSAYSPGSAHSPGSAHSTPGPPGTTQPGEKPTKPSCVSMVQEGTTQ
AWRRLSPEMEAGGIQTVEDEQVADLTLMGEGDISSPNSTLLPPPPTPQDTPGPPRPGTSR
F
Download sequence
Identical sequences Q8CGE9
NP_775578.2.92730 ENSMUSP00000030984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]