SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8DAS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DAS3
Domain Number 1 Region: 55-233
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.76e-44
Family Pseudouridine synthase RsuA/RluD 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8DAS3
Sequence length 234
Comment (sp|Q8DAS3|RLUE_VIBVU) rRNA-uridine isomerase E OX=216895 OS=Vibrio vulnificus (strain CMCP6). GN=rluE; OC=Vibrionaceae; Vibrio.
Sequence
MSFRSSSTSPRSNKQTATKRFKQSGQAQSVGSPKRHSVKRKNNEQSKKSLSLAERKIIIF
NKPYDTLSQFTDGEGRKTLADFIPVKEVYAAGRLDRDSEGLMVLTNDGILQAKLTQPKSK
SPKTYWVQVEGAPTEAQLEPLRRGVELKDGLTLPAQVEIIQDPQLWERNPPVRFRAAIPT
TWLAITIIEGRNRQVRRMTAHIGFPTLRLVRYSMGGMTLQDLQPGEWKEISLPS
Download sequence
Identical sequences Q7MJ37 Q8DAS3
gi|27365449|ref|NP_760977.1| WP_011080000.1.16238 WP_011080000.1.17874 WP_011080000.1.34622 WP_011080000.1.39407 WP_011080000.1.54486 WP_011080000.1.55006 WP_011080000.1.90288 WP_011080000.1.9921 WP_011080000.1.99976 gi|37680510|ref|NP_935119.1| 196600.VV2326 216895.VV1_2116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]