SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8DH05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DH05
Domain Number 1 Region: 252-499
Classification Level Classification E-value
Superfamily HemD-like 1.28e-73
Family HemD-like 0.0043
Further Details:      
 
Domain Number 2 Region: 2-227
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.01e-50
Family Tetrapyrrole methylase 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8DH05
Sequence length 501
Comment (tr|Q8DH05|Q8DH05_THEEB) Porphyrin biosynthesis protein {ECO:0000313|EMBL:BAC09707.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=hemD OC=Thermosynechococcus.
Sequence
MGAGLGTPSSLTLEAWTCLQQAQVVLYDALLSPSLLELTPADCLRVAVGKRAGAEAIPQL
EINRLLVAYGQQYQRVVRLKSGDPGLFGRLHQELEAVLGAGLEAVVIAGVSSALAAPLLA
GICVTAKDVSQSVAILSGHAPETLPWPAIARMETLIFLMATRSLRYIAEALLRQGRSPTE
GLAILQWAGQPQQQFWFGTLESYLQSPQFPDMAPAVVVIGAIARKRYPLASLDLVFPEFL
RISPSSMSALHGKTILVTRAAAQASDFTQQLTAAGATVLEMPTLEIVPPSSWQPLDQALA
QLDTFDWLILTSHNAVTFFMKRLHSHGKDSRALAGLKIAVVGEKTAQTLNRYGLVADFTP
REFVADALVVEFPEPVAGLRFLFPRVEKGGRPVLGEAFTAAGAEVVEVPAYNSRCPQTVD
APVLAALQAGQVDIVTFTSSKTVKHFCQLVGPQAAELLQNVQIASIGPQTSQTCRELLGR
VDTEATEHTLEGLLQALLRIT
Download sequence
Identical sequences Q8DH05
197221.tlr2155 NP_682945.1.97157 gi|22299698|ref|NP_682945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]